PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400056041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 149aa    MW: 17036.8 Da    PI: 10.233
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400056041genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.18.6e-27959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss
  PGSC0003DMP400056041  9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59
                          68***********************************************96 PP

2K-box24.51.1e-0984142967
                 K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRs 67 
                           l++++  s ++ +a L +   +  re+R+l Ge+L+ L l +L++Le+ +e +++++ +
  PGSC0003DMP400056041  84 LHSSNLLSEKKTHAMLSRDFVEKNRELRQLHGEELQGLGLDDLMKLEKLVEGGISRVLK 142
                           66777777778888888888888899*****************************9965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-26323IPR002100Transcription factor, MADS-box
CDDcd002659.81E-38376No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-30383IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.24389148IPR002487Transcription factor, K-box
PfamPF014861.2E-593143IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS  60
SMMQLIEKHK MQSERDSMDN PEQLHSSNLL SEKKTHAMLS RDFVEKNREL RQLHGEELQG  120
LGLDDLMKLE KLVEGGISRV LKIKVLFT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-18174174Myocyte-specific enhancer factor 2B
1tqe_R4e-18174174Myocyte-specific enhancer factor 2B
1tqe_Q4e-18174174Myocyte-specific enhancer factor 2B
1tqe_P4e-18174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0086520.0AF008652.1 Solanum tuberosum MADS transcriptional factor (Stmads11) mRNA, complete cds.
GenBankAY6437250.0AY643725.1 Solanum tuberosum MADS11 (MADS11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006351733.11e-100PREDICTED: MADS transcriptional factor isoform X1
SwissprotQ9FVC16e-52SVP_ARATH; MADS-box protein SVP
TrEMBLM1D7281e-104M1D728_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000837391e-99(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-41MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]